All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (7)
- (2)
- (3,051)
- (925)
- (1,939)
- (4,412)
- (1)
- (1)
- (3)
- (1)
- (1,258)
- (1,754)
- (921,451)
- (21,592)
- (2)
- (774)
- (61)
- (1)
- (29)
- (1)
- (5,588)
- (3,360)
- (1,862)
- (218)
- (1)
- (8,787)
- (12,059)
- (2,271)
- (9)
- (52)
- (1)
- (3)
- (4)
- (13)
- (2)
- (69)
- (5)
- (11)
- (12,287)
- (15,879)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (13)
- (2,669)
- (535)
- (1)
- (1)
- (136)
- (422)
- (3)
- (1)
- (3)
- (16)
- (110)
- (1)
- (190,046)
- (288,133)
- (1)
- (19)
- (798)
- (1)
- (12,221)
- (2)
- (130)
- (1)
- (2)
- (5)
- (11)
- (4)
- (9)
- (1)
- (2)
- (12)
- (34)
- (3)
- (1)
- (4)
- (1)
- (108)
- (1)
- (20)
- (19)
- (46)
- (1)
- (5)
- (1)
- (1)
- (10,751)
- (652)
- (1)
- (2)
- (1)
- (4)
- (6)
- (6)
- (1)
- (8)
- (3)
- (16)
- (2)
- (2)
- (329)
- (359)
- (5)
- (13,022)
- (2)
- (4,300)
- (2,250)
- (1)
- (14)
- (33)
- (1)
- (7)
- (1)
- (6,043)
- (3,904)
- (1)
- (20)
- (1)
- (1)
- (2)
- (40)
- (1)
- (2)
- (1)
- (17,537)
- (16,769)
- (18)
- (1)
- (1)
- (1)
- (5,550)
- (3)
- (2)
- (43)
- (4)
- (13)
- (1)
- (164)
- (748)
- (17)
- (2)
- (6)
- (1)
- (1)
- (2)
- (2,085)
- (1)
- (9)
- (3)
- (1)
- (1)
- (2)
- (6)
- (2)
- (2)
- (104)
- (1)
- (1)
- (3,872)
- (2)
- (20)
- (3)
- (112)
- (1)
- (1)
- (5)
- (2)
- (3)
- (33)
- (1)
- (5)
- (187)
- (2)
- (4,823)
- (12)
- (1)
- (2)
- (5)
- (9)
- (4)
- (7)
- (23)
- (130)
- (8,952)
- (39,658)
- (448)
- (53)
- (1,929)
- (1)
- (36)
- (7)
- (1)
- (2,681)
- (1)
- (4,480)
- (42)
- (2)
- (2)
- (1)
- (1)
- (4)
- (50)
- (1)
- (1)
- (815)
- (1)
- (1)
- (2)
- (2)
- (32)
- (40)
- (4)
- (6)
- (3)
- (6)
- (1)
- (3)
- (1)
- (3)
- (3)
- (31,162)
- (9)
- (1)
- (29)
- (2,893)
- (74)
- (89)
- (275)
- (2)
- (55)
- (29,965)
- (29,827)
- (6)
- (32,471)
- (16)
- (29,774)
- (45)
- (866)
- (48)
- (595)
- (30,794)
- (1)
- (32,528)
- (1)
- (3)
- (1)
- (73)
- (3)
- (30,317)
- (29,972)
- (3)
- (24,399)
- (24,966)
- (24,937)
- (24,831)
- (24,994)
- (24,794)
- (23)
- (127)
- (5)
- (103)
- (106)
- (2)
- (1)
- (92)
- (6)
- (15)
- (5)
- (34,906)
- (11)
- (3)
- (221)
- (761)
- (1,058)
- (721)
- (777)
- (920)
- (889)
- (1,009)
- (850)
- (1,472)
- (912)
- (835)
- (1,058)
- (1,061)
- (1,056)
- (681)
- (1,087)
- (30,490)
- (90)
- (9)
- (42)
- (17)
- (1)
- (103)
- (1)
- (139)
- (3)
- (79)
- (28,930)
- (28,983)
- (29,280)
- (63)
- (28,999)
- (25,597)
- (1)
- (60)
- (28,923)
- (28,575)
- (28,539)
- (17)
- (9)
- (1)
- (1)
- (7)
- (5)
- (33,652)
- (5)
- (30)
- (1)
- (1)
- (338)
- (735)
- (30,825)
- (1)
- (30,923)
- (27,238)
- (17,685)
- (17,678)
- (27,221)
- (30,927)
- (38)
- (1)
- (47)
- (9)
- (13)
- (2)
- (99)
- (11)
- (22)
- (58)
- (26)
- (127)
- (158)
- (25)
- (84)
- (58)
- (24)
- (56)
- (76)
- (9)
- (65)
- (73)
- (95)
- (84)
- (78)
- (28)
- (64)
- (70)
- (44)
- (58)
- (50)
- (53)
- (98)
- (122)
- (41)
- (58)
- (65)
- (77)
- (75)
- (454)
- (32,848)
- (7)
- (4)
- (311)
- (417)
- (2,778)
- (3,757)
- (24)
- (3)
- (37)
- (214)
- (2,662)
- (155)
- (41)
- (27,786)
- (558)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (858)
- (142)
- (536)
- (429)
- (878)
- (402)
- (325)
- (815)
- (756)
- (721)
- (2)
- (630)
- (722)
- (290)
- (752)
- (822)
- (634)
- (807)
- (12)
- (29)
- (116)
- (5)
- (274)
- (250)
- (125)
- (126)
- (95)
- (46)
- (11)
- (6)
- (5)
- (9)
- (3)
- (8)
- (2)
- (64)
- (14)
- (542,719)
- (7)
- (266)
- (49)
- (2)
- (367)
- (68)
- (47)
- (25)
- (271)
- (3)
- (3)
- (4)
- (29,993)
- (30,024)
- (29,977)
- (565)
- (2,896)
- (51)
- (1)
- (15)
- (1,780)
- (726)
- (3)
- (2)
- (6)
- (4)
- (5)
- (111,672)
- (68)
- (124)
- (2,111)
- (31,240)
- (221)
- (8)
- (23)
- (597,727)
- (16)
- (1)
- (800,301)
- (84,209)
- (3)
- (45,153)
- (174)
- (1)
- (1)
- (571)
- (2)
- (36)
- (23)
- (187)
- (1,232)
- (3)
- (4)
- (468)
- (98)
- (1)
- (1,429)
- (3)
- (2)
- (7)
- (2)
- (127)
- (2)
- (9)
- (95)
- (164)
- (51)
- (745)
- (1)
- (5)
- (8,432)
- (7,041)
- (12)
- (2)
- (1)
- (27)
- (27)
- (6)
- (161)
- (292)
- (1)
- (74)
- (2)
- (10,238)
- (43)
- (425)
- (171)
- (2,278)
- (156)
- (6)
- (348)
- (2)
- (1)
- (120)
- (1)
- (9)
- (10)
- (27)
- (84)
- (2)
- (23)
- (1)
- (677)
- (56)
- (8)
- (21)
- (109,131)
- (2)
- (2)
- (57)
- (70)
- (275)
- (18)
- (1,253)
- (6,085)
- (2)
- (7)
- (2)
- (2,152)
- (6)
- (57)
- (432,730)
- (31)
- (20,758)
- (15,649)
- (1,535)
- (377)
- (219)
- (79)
- (10,492)
- (4)
- (170)
- (28)
- (2)
- (28)
- (25)
- (1,047)
- (7)
- (2)
- (9)
- (18)
- (2)
- (1)
- (2)
- (92)
- (10)
- (2)
- (349,568)
- (2,675)
- (43,523)
- (93)
- (2)
- (50)
- (41)
- (1)
- (1)
- (4)
- (167)
- (2)
- (32,423)
- (127)
- (2)
- (1)
- (2)
- (150)
- (893)
- (15,271)
- (3)
- (2)
- (168)
- (30)
- (2)
- (2)
- (10)
- (819)
- (3)
- (2)
- (2)
- (2)
- (2)
- (10)
- (87)
- (64)
- (3)
- (337)
- (1,422)
- (2,837)
- (4)
- (290,235)
- (153,811)
- (191)
- (53)
- (197,230)
- (502,588)
- (77)
- (1,445)
- (43,005)
- (14)
- (267)
- (12,831)
- (529,562)
- (202)
- (609)
- (2)
- (3)
- (551)
- (6)
- (4)
- (211,659)
- (2,647)
- (27)
- (10)
- (51)
- (526)
- (25)
- (270)
- (1,156)
- (1,424)
- (7)
- (8)
- (1,340)
- (4)
- (2)
- (3)
- (26)
- (6,535)
- (1)
- (6)
- (814)
- (32)
- (9)
- (2)
- (434)
- (4)
- (4)
- (2)
- (22)
- (48)
- (1,208)
- (2)
- (16)
- (1,835)
- (1)
- (4)
- (2)
- (261)
- (437)
- (1,280)
- (39)
- (6)
- (43,438)
- (22)
- (1)
- (917)
- (85)
- (835)
- (1,910)
- (5)
- (2)
- (3)
- (2)
- (2)
- (22,381)
- (10)
- (1)
- (4)
- (1,390)
- (9)
- (2)
- (4)
- (135)
- (2)
- (1)
- (2,798)
- (105)
- (3)
- (13)
- (33)
- (1,513)
- (5)
- (2)
- (9,778)
- (4,867)
- (3,679)
- (1)
- (41)
- (11)
- (4,367)
- (2)
- (460)
- (442)
- (4)
- (26)
- (14)
- (52)
- (14)
- (2,648)
- (258)
- (3)
- (1)
- (1)
- (29)
- (13)
- (39)
- (2)
- (1)
- (2)
- (3)
- (1)
- (2)
- (1)
- (1,080,988)
- (3)
- (9,440)
- (19)
- (1)
- (51)
- (10)
- (74)
- (3)
- (3)
- (90)
- (40)
- (106)
- (494)
- (5)
- (728)
- (150)
- (62)
- (882)
- (8)
- (35)
- (8)
- (22)
- (5)
- (4)
- (2)
- (867)
- (2)
- (2,269)
- (51)
- (2)
- (5,101)
- (436)
- (1)
- (4)
- (24)
- (3)
- (4)
- (4)
- (8)
- (1)
- (2)
- (19,897)
- (1,027)
- (2,074)
- (426)
- (62)
- (1,190)
- (4)
- (9)
- (53)
- (9)
- (4)
- (47)
- (8)
- (29,699)
- (821)
- (2)
- (2)
- (4)
- (8)
- (5)
- (1,307)
- (9,923)
- (376)
- (1,447)
- (20)
- (855)
- (4)
- (2)
- (30)
- (2)
- (1)
- (1,022)
- (3)
- (9)
- (1)
- (18)
- (3)
- (2)
- (1,266)
- (3,505)
- (371)
- (2)
- (42)
- (5)
- (3)
- (4)
- (3)
- (6)
- (1,888)
- (12)
- (39)
- (4)
- (2,383)
- (164)
- (135)
- (50)
- (1,477)
- (263)
- (2)
- (14)
- (18)
- (1)
- (21)
- (4,674)
- (173)
- (44)
- (1)
- (2)
- (2)
- (5,218)
- (68)
- (578)
- (300)
- (3)
- (108)
- (1)
- (1,572)
- (43)
- (4)
- (2)
- (9)
- (497)
- (21)
- (352)
- (3)
- (3)
- (6)
- (149)
- (145)
- (1)
- (1,779)
- (126)
- (168)
- (42)
- (3)
- (2)
- (176)
- (1)
- (2)
- (36)
- (3,494)
- (218)
- (407)
- (1)
- (274)
- (240)
- (236)
- (160)
- (9)
- (15)
- (11)
- (5)
- (5,224)
- (308)
- (6)
- (10)
- (1)
- (4)
- (52)
- (23)
- (73)
- (2)
- (28)
- (709)
- (1,433,813)
- (695)
- (9)
- (19)
- (1)
- (5)
- (78)
- (519)
- (89)
- (57)
- (15)
- (80)
- (42)
- (441)
- (524)
- (3)
- (15)
- (4)
- (17)
- (107)
- (9)
- (17)
- (2)
- (24)
- (1)
- (24)
- (2)
- (2)
- (16)
- (59)
- (2)
- (18)
- (2)
- (496)
- (8)
- (1)
- (890)
- (1,201)
- (2)
- (8)
- (4)
- (59)
- (139)
- (4)
- (268)
- (1)
- (13)
- (23,998)
- (90)
- (8)
- (2)
- (3)
- (1)
- (571,410)
- (4,877)
- (1,533)
- (1)
- (254)
- (2)
- (3)
- (30)
- (28)
- (8)
- (798)
- (7,444)
- (5)
- (4)
- (46)
- (1,310)
- (23)
- (279)
- (113)
- (1)
- (143)
- (182)
- (1)
- (3)
- (13)
- (20)
- (62)
- (5)
- (6)
- (9)
- (17)
- (207)
- (18)
- (18,492)
- (545)
- (215)
- (25)
- (1,235)
- (6)
- (1)
- (3)
- (1)
- (3)
- (124)
- (11)
- (5)
- (14,722)
- (155)
- (401)
- (10)
- (4)
- (6)
- (62)
- (10,253)
- (532)
- (4)
- (10)
- (2)
- (338,714)
- (5,177)
- (2)
- (6)
- (399)
- (2)
- (33)
- (2,777)
- (1,119)
- (3)
- (10)
- (30)
- (65)
- (153)
- (57)
- (2)
- (247)
- (31)
- (36)
- (3)
- (951)
- (2)
- (5,182)
- (2)
- (1)
- (15)
- (2)
- (22)
- (1)
- (1)
- (2)
- (13)
- (1)
- (2)
- (1)
- (13)
- (3,894)
- (471)
- (1)
- (2)
- (19)
- (5)
- (6)
- (3)
- (9)
- (54)
- (8)
- (3)
- (1)
- (4)
- (87)
- (10)
- (2)
- (24)
- (2)
- (2)
- (42)
- (3)
- (2)
- (2)
- (23)
- (82)
- (2,574)
- (1)
- (8)
- (23)
- (2)
- (3)
- (1,402)
- (6)
- (22)
- (13)
- (4)
- (4)
- (202)
- (5)
- (1,337)
- (38)
- (6)
- (3)
- (19,935)
- (2)
- (50)
- (2)
- (5)
- (3)
- (148)
- (339)
- (183)
- (2,287)
- (1,820)
- (30)
- (16)
- (2)
- (2)
- (4,513)
- (5)
- (9)
Filtered Search Results
CD19 Monoclonal Antibody (SJ25C1), Alexa Fluor™ 700, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 700 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P15391 |
| Concentration | 5 μL/Test |
| Antigen | CD19 |
| Gene Symbols | Cd19 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12 |
| Gene | Cd19 |
| Product Type | Antibody |
| Gene ID (Entrez) | 930 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | SJ25C1 |
CD25 Monoclonal Antibody (PC61.5), APC-eFluor™ 780, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | APC-eFluor 780 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 λ |
| Gene Accession No. | P01590 |
| Concentration | 0.2 mg/mL |
| Antigen | CD25 |
| Gene Symbols | IL2RA |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | ADA; ADA1; Adenosine aminohydrolase; adenosine deaminase; CD25; CD25 antigen; cytokine receptor; IDDM10; IL 2 RA; IL 2 receptor; IL 2R; IL 2R subunit alpha; IL2 RA; IL2 RA antibody; IL2 receptor; il-2 receptor alpha; IL-2 Receptor alpha chain; IL-2 receptor alpha subunit; IL2 receptor subunit alpha; IL-2 receptor subunit alpha; IL2R; IL-2R alpha; IL-2R alpha chain; IL2R subunit alpha; IL-2R subunit alpha; Il2ra; IL-2RA; IL-2-RA; IL2-RA; Il2ra antibody; IL2RAC; IMD41; interleukin 2 receptor; interleukin 2 receptor alpha chain; interleukin 2 receptor subunit alpha; interleukin 2 receptor, alpha; interleukin 2 receptor, alpha chain; interleukin-2 receptor alpha; interleukin-2 receptor alpha chain; interleukin-2 receptor alpha subunit; interleukin-2 receptor beta chain; Interleukin2 receptor subunit alpha; interleukin-2 receptor subunit alpha; Ly-43; p55; p55 chain; sIL 2R; soluble IL 2 receptor; TAC antigen; TCGFR |
| Gene | IL2RA |
| Product Type | Antibody |
| Gene ID (Entrez) | 16184 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | PC61.5 |
Invitrogen™ V5 Tag Monoclonal Antibody (TCM5), PE, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Concentration | 5 μL/Test |
| Antigen | V5 Tag |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | simian virus 5 antibody; SPV5gp2; sv5; V5; v-5; V5 Epitope Tag |
| Product Type | Antibody |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Immunogen | Peptide sequence-GKPIPNPLLGLDST. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | TCM5 |
CD271 (NGF Receptor) Monoclonal Antibody (ME20.4), APC, eBioscience™, Invitrogen™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human,Mouse,Rat,Canine,Rabbit,Monkey,Sheep,Pig |
| Host Species | Mouse |
| Conjugate | APC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG1 κ |
| Gene Accession No. | P07174, P08138, Q9Z0W1 |
| Concentration | 5 μL/Test |
| Antigen | CD271 (NGF Receptor) |
| Gene Symbols | Ngfr |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | CD271; CD271 antigen; Gp80-LNGFR; LNGFR; low affinity nerve growth factor receptor; low affinity neurotrophin receptor p75NTR; LOW QUALITY PROTEIN: tumor necrosis factor receptor superfamily member 16; low-affinity nerve growth factor receptor; nerve growth factor receptor; nerve growth factor receptor (TNFR superfamily, member 16); nerve growth factor receptor, fast; NGF receptor; NGFR; NGR; p75; p-75; p75 ICD; p75 neurotrophin receptor; p75 ntr; p75(NTR); p75NGFR; p75NTR; RNNGFRR; TNFR superfamily, member 16; Tnfrsf16; TNR16; Tumor necrosis factor receptor superfamily member 16 |
| Gene | Ngfr |
| Product Type | Antibody |
| Gene ID (Entrez) | 100349095, 100525607, 101119064, 18053, 24596, 4804, 491071 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | ME20.4 |
Invitrogen™ HLA-ABC Monoclonal Antibody (W6/32), Biotin, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Biotin |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P01889, P04439, P10321 |
| Isotype | IgG2a κ |
| Concentration | 0.5 mg/mL |
| Antigen | HLA-ABC |
| Gene Symbols | HLA-A, HLA-B, HLA-C |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | A29 protein; alpha chain of MHC class II; antigen presenting molecule; AS; Aw-33; Aw-74; B-4901; B-5001; Bw-47; Bw-50; class I MHC, HLA-B antigen; D6S204; epididymis secretory protein Li 83; H-2K; H2-K; H-2K(d); HEL-S-83; histocompatibility antigen; HLA A; HLA -B; HLA B-40011; HLA B44; HLA C; HLA class I antigen; HLA class I antigen HLA-B; HLA class I histocompatibility antigen C alpha chain; HLA class I histocompatibility antigen Cw-1 alpha chain; HLA class I histocompatibility antigen, A alpha chain; HLA class I histocompatibility antigen, A-1 alpha chain; HLA class I histocompatibility antigen, A-11 alpha chain-like; HLA class I histocompatibility antigen, A-30 alpha chain; HLA class I histocompatibility antigen, A-33 alpha chain; HLA class I histocompatibility antigen, A-74 alpha chain; HLA class I histocompatibility antigen, B alpha chain; HLA class I histocompatibility antigen, B-47 alpha chain; HLA class I histocompatibility antigen, B-50 alpha chain; HLA class I histocompatibility antigen, B-82 alpha chain; HLA class I histocompatibility antigen, C alpha chain; HLA class I histocompatibility antigen, Cw-1 alpha chain; HLA class I histocompatibility antigen, Cw-15 alpha chain; HLA class I histocompatibility antigen, Cw-18 alpha chain; HLA locus; HLA molecule; HLAA; HLA-A; HLA-A locus alpha 2 domain; HLA-A null; HLA-A11; HLA-A33; HLA-Aw33.1; HLAB; HLA-B; HLA-B 1502; HLA-B alpha chain; HLA-B alpha chain (B*2706); HLA-B alpha chain (B*5002); HLA-B alpha-chain; HLA-B*45ZJ; HLA-B15; HLA-B35; HLA-B35 antigen; HLA-B-3506; HLA-B39; HLA-B-3905; HLA-B49; HLA-B50; HLA-B55; HLA-B-5502; HLA-B-5602; HLA-B59; HLA-B61; HLA-Bw50 antigen; HLAC; HLA-C; HLA-C alpha chain; HLA-C alpha chain (HLA-Cw*15v); HLA-C alpha chain for Cw*18GB; HLA-C alpha-chain; HLA-C antigen; HLA-Cw; HLA-Cw*04GB; HLA-Cw*1702; HLA-Cw*18GB; HLA-Cw-1503; HLA-DQB1; HLA-DRB1; HLA-JY3; HLC-C; Human leukocyte antigen A; Human leukocyte antigen C; human leukocyte antigen-C alpha chain; hypothetical protein; lecocyte antigen B; leucocyte antigen A; Leukocyte Antigen; leukocyte antigen C; leukocyte antigen class I-A; leukocyte antigen class I-B; Leukoocyte Antigen; LOC100515902; LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-11 alpha chain-like; lymphocyte antigen; major histocompatability complex B antigen; major histocompatibility antigen HLA-C; major histocompatibility complex, class I, A; major histocompatibility complex, class I, B; major histocompatibility complex, class I, C; MCH class I antigen; MGC184092; MGC7052; MHC; MHC 1; MHC antigen; MHC clas I antigen; MHC Class 1; MHC class 1 antigen; MHC class I; MHC class I alpha chain; MHC class I anitgen; MHC class I anti; MHC Class I antigen; MHC class I antigen A*30; MHC class I antigen A*33; MHC class I antigen A*74; MHC class I antigen B*47; MHC class I antigen B*50; MHC class I antigen B*82; MHC class I antigen Cw*15; MHC class I antigen Cw*18; MHC class I antigen GN00104; MHC class I antigen heavy chain; MHC class I antigen heavy chain HLA-C; MHC class I antigen HLA-A heavy chain; MHC class I antigen HLA-A33; MHC class I antigen HLA-B alpha chain; MHC class I antigen HLA-B heavy chain; MHC class I antigen null protein; MHC class I antigen SHCHA; MHC class I antigene; MHC class I histocompatibility antigen; MHC class I human leukocyte antigen; MHC class I molecule; MHC class I protein; MHC class II antigen; MHC class l antigen; MHC classI antigen; MHC HLA-ABC; MHC HLA-B cell surface glycoprotein; MHC HLA-B transmembrane glycoprotein; MHC HLA-B27d; MHC HLA-B27-HS; MHC HLA-B39N; MHC I HLA; MHC1; PSORS1; SPDA1; surface antigen; truncated class I antigen; truncated MHC class I antigen |
| Gene | HLA-B |
| Product Type | Antibody |
| Gene ID (Entrez) | 3105, 3106, 3107 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | W6/32 |
Invitrogen™ CD38 Monoclonal Antibody (HIT2), FITC
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | FITC |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P28907 |
| Isotype | IgG1 |
| Antigen | CD38 |
| Gene Symbols | CD38 |
| Regulatory Status | ASR |
| Purification Method | Purified |
| Gene Alias | 2'-phospho-ADP-ribosyl cyclase; 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase; 2'-phospho-cyclic-ADP-ribose transferase; ADPRC 1; ADPRC1; ADP-ribosyl cyclase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1; cADPr hydrolase 1; Cd38; CD38 antigen; CD38 antigen (ADP-ribosyl cyclase / cyclic ADP-ribose hydrolase); CD38 antigen (p45); CD38 antigen p45; CD38 molecule; CD38H; Cd38-rs1; cluster of differentiation 38; cyclic ADP-ribose hydrolase 1; ecto-nicotinamide adenine dinucleotide glycohydrolase; I-19; NAD(+) nucleosidase; NAD+ nucleosidase; NIM-R5 antigen; T10 |
| Gene | CD38 |
| Product Type | Antibody |
| Gene ID (Entrez) | 952 |
| Formulation | PBS with 4mg/mL BSA and 0.1% sodium azide |
| Immunogen | Human CD38. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIT2 |
Invitrogen™ Neurogenin 2 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P70447, Q9H2A3 |
| Isotype | IgG |
| Concentration | 1.13 mg/mL |
| Antigen | Neurogenin 2 |
| Gene Symbols | NEUROG2 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | Ath4a; ATOH4; atonal homolog 4; bHLHa8; Class A basic helix-loop-helix protein 8; helix-loop-helix protein mATH-4A; mATH4A; NEUROG2; neurogenin 2; neurogenin2; neurogenin-2; NGN2; NGN-2; Protein atonal homolog 4 |
| Gene | NEUROG2 |
| Product Type | Antibody |
| Gene ID (Entrez) | 11924, 295475, 63973 |
| Formulation | PBS with 20% glycerol and 0.025% ProClin 300; pH 7 |
| Immunogen | Recombinant protein encompassing a sequence within the center region of human Neurogenin 2. The exact sequence is proprietary. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ CD49a Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Sheep Polyclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human |
| Host Species | Sheep |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P56199 |
| Isotype | IgG |
| Concentration | 0.2 mg/mL |
| Antigen | CD49a |
| Gene Symbols | Itga1 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | CD49 antigen-like family member A; CD49a; E130012M19Rik; integrin alpha 1; integrin alpha-1; integrin subunit alpha 1; integrin, alpha 1; Itga1; Laminin and collagen receptor; very late activation protein 1; Vla1; VLA-1 |
| Gene | Itga1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 3672 |
| Formulation | PBS with 5% trehalose and No Preservative |
| Immunogen | CHO-derived recombinant human Integrin alpha 1/CD49a Phe29-Pro1141. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ Prodynorphin Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Guinea Pig Polyclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Mouse,Rat |
| Host Species | Guinea Pig |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Frozen) |
| Form | Liquid |
| Gene Accession No. | O35417, P06300 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | Prodynorphin |
| Gene Symbols | Pdyn |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | ADCA; Alpha-neoendorphin; beta-neoendorphin; Beta-neoendorphin-dynorphin; Big Dyn; Big dynorphin; Dyn; Dyn-A17; Dyn-B; Dynorphin A(1-13); dynorphin A(1-17); Dynorphin A(1-8); Dynorphin B; Dynorphin B(1-13); Dynorphin B-29; Leu-enkephalin; leumorphin; neoendorphin-dynorphin-enkephalin prepropeptide; PDYN; PENKB; Preprodynorphin; preproenkephalin B; prodynorphin; proenkephalin B; proenkephalin-B; Rimorphin; SCA23; unnamed protein product |
| Gene | Pdyn |
| Product Type | Antibody |
| Gene ID (Entrez) | 18610, 29190 |
| Formulation | PBS with 30% glycerol and 0.05% sodium azide |
| Immunogen | SQENPNTYSEDLDV. Corresponding to residues 235-248 of the rat proDynorphin. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ SMAD3 Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ChIP Assay,ELISA,Immunohistochemistry,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P84022 |
| Isotype | IgG |
| Concentration | 0.25 mg/mL |
| Antigen | SMAD3 |
| Gene Symbols | Smad3 |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | AU022421; DKFZp586N0721; DKFZp686J10186; hMAD-3; hSMAD3; HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MAD (mothers against decapentaplegic, Drosophila) homolog 3; MAD homolog 3; MAD homolog 3a; mad homolog JV15-2; mad protein homolog; MAD, mothers against decapentaplegic homolog 3; mad3; MAD-3; madh3; madh3a; madh3-A; MGC60396; mMad3; mothers against decapentaplegic homolog 3; mothers against decapentaplegic homolog 3a; mothers against DPP homolog 3; SMA- and MAD-related protein 3; SMAD; Smad 3; SMAD family member 3; SMAD family member 3 L homeolog; SMAD family member 3a; SMAD, mothers against DPP homolog 3; Smad3; smad3.L; smad3a; TGF beta response effector Smad3; TGF-beta response effector Smad3; transcription factor; transcription factor Smad3; wu:fa99e03; XELAEV_18018454mg; XenMLP; Xmad3; XSmad3 |
| Gene | Smad3 |
| Product Type | Antibody |
| Gene ID (Entrez) | 4088 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | A 20 amino acid synthetic peptide derived from a central portion of the linker domain of human Smad3. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
MHC Class II (I-A/I-E) Monoclonal Antibody (M5/114.15.2), Biotin, eBioscience™, Invitrogen™
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Mouse |
| Host Species | Rat |
| Conjugate | Biotin |
| Applications | Flow Cytometry |
| Form | Liquid |
| Isotype | IgG2b κ |
| Gene Accession No. | P01910, P01921, P04227, P04228, P04230, P06342, P06343, P06344, P06345, P06346, P14434, P14435, P14436, P14437, P14438, P14483, P23150 |
| Concentration | 0.5 mg/mL |
| Antigen | MHC Class II (I-A/I-E) |
| Gene Symbols | H2-Aa, H2-Ab1, H2-Eb1 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Abeta; AI323765; AI845868; cell surface glycoprotein; E-alpha-f; H-2 class II histocompatibility antigen, A beta chain; H-2 class II histocompatibility antigen, E-D alpha chain; H-2 class II histocompatibility antigen, E-K alpha chain; H-2 class II histocompatibility antigen, E-U alpha chain; H-2 class II histocompatibility antigen, I-E beta chain; H-2Ab; H2-Ab; H2-Ab1; H-2Ea; H2-Ea; H2-Ea-ps; H2Eb; H-2Eb; H2-Eb1; H2-iabeta; H2-IE-alpha; histocompatibility 2, class II antigen A, beta 1; histocompatibility 2, class II antigen E alpha; histocompatibility 2, class II antigen E alpha, pseudogene; histocompatibility 2, class II antigen E beta; Ia2; Ia-2; Ia3; Ia-3; Ia4; Ia-4; IAb; I-Ab; I-Abeta; I-Ad; I-Aq; I-E alpha MHC class II; I-E beta MHC class II; I-Ealpha; I-Ed; I-Ek; major histocompatibility complex class II beta chain; major histocompatibility complex H-2E beta chain; MHC class 2; MHC class II antigen A beta; MHC class II antigen E alpha; MHC class II H2-IA-beta-psi; MHC class II IE-b; MHC class II protein; MHC H2-IE-beta cell surface glycoprotein; response to metastatic cancers 1; Rmcs1 |
| Gene | H2-Eb1 |
| Product Type | Antibody |
| Gene ID (Entrez) | 14960, 14961, 14969 |
| Formulation | PBS with 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | M5/114.15.2 |
Invitrogen™ Integrin beta 7 Monoclonal Antibody (FIB504), PE, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rat Monoclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rat |
| Conjugate | PE |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P26010, P26011 |
| Isotype | IgG2a κ |
| Concentration | 5 μL/Test |
| Antigen | Integrin beta 7 |
| Gene Symbols | ITGB7 |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | Gut homing receptor beta subunit; integrin beta 7; integrin beta 7 subunit; integrin beta-7; Integrin beta-P; integrin subunit beta 7; integrin, beta 7; ITGB7; Ly69; M290 IEL antigen |
| Gene | ITGB7 |
| Product Type | Antibody |
| Gene ID (Entrez) | 16421, 3695 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | FIB504 |
Invitrogen™ 14-3-3 Pan Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | Maintain refrigerated at 2-8°C for up to 1 month. For long term storage store at -20°C |
|---|---|
| Target Species | Human,Mouse,Rat,Bovine,Frog |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | O70456, P27348, P31946, P31947, P35213, P61981, P61982, P61983, P62258, P62259, P62260, P62261, P63101, P63102, P63103, P63104, P68250, P68252, P68254, P68255, Q0VC36, Q3SZI4, Q52M98, Q5XHK2, Q6NRY9, Q6PCG0, Q8AVQ3, Q9CQV8 |
| Isotype | IgG |
| Concentration | 0.25 mg/mL |
| Antigen | 14-3-3 Pan |
| Gene Symbols | Sfn, YWHAB, ywhab.L, ywhab.S, YWHAE, YWHAG, ywhag.L, ywhag.S, YWHAQ, YWHAZ |
| Regulatory Status | RUO |
| Purification Method | Antigen affinity chromatography |
| Gene Alias | 1110013I11Rik; 1300003C17Rik; 14-3-3; 14-3-3 alpha; 14-3-3 beta; 14-3-3 delta; 14-3-3 epsilon; 14-3-3 gamma; 14-3-3 protein beta; 14-3-3 protein beta/alpha; 14-3-3 protein beta/alpha, N-terminally processed; 14-3-3 protein beta/alpha-A; 14-3-3 protein beta/alpha-B; 14-3-3 protein beta-subtype; 14-3-3 protein epsilon; 14-3-3 protein gamma; 14-3-3 protein gamma subtype; 14-3-3 protein gamma, N-terminally processed; 14-3-3 protein gamma-A; 14-3-3 protein gamma-B; 14-3-3 protein gamma-subtype; 14-3-3 protein sigma; 14-3-3 protein tau; 14-3-3 protein T-cell; 14-3-3 protein theta; 14-3-3 protein zeta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 sigma; 14-3-3 sigma protein; 14-3-3 tau; 14-3-3 theta; 14-3-3 zeta; 14-3-3beta; 14-3-3d; 14-3-3E; 14-3-3G; 14-3-3gamma; 14-3-3-like protein; 14-3-3t; 14-3-3z; 14-3-3zeta; 14-3-3-zeta; 1C5; 2700028P07Rik; 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; 3-monooxgenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 3-monooxygenase/tryptophan 5 monooxygenase activation protein beta polypeptide; 3-monooxygenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; AA409740; AI596267; AL022924; AU019196; AU020854; AU021156; brain protein 14-3-3, beta isoform; D7Bwg1348e; epididymis luminal protein 2; epididymis luminal protein 4; epididymis secretory protein Li 1; epididymis secretory protein Li 3; epididymis secretory protein Li 93; epithelial cell marker protein 1; Er; factor activating exoenzyme S; FAS; GW128; HEL2; HEL4; HEL-S-1; HEL-S-3; HEL-S-93; HME1; HS1; KCIP-1; MDCR; MDS; mitochondrial import stimulation factor (MSF) L subunit; mitochondrial import stimulation factor L subunit; Mitochondrial import stimulation factor S1 subunit; Mkrn3; Mme1; MSF L; Msfs1; phospholipase A2; PPP1R170; prepronerve growth factor RNH-1; Protein 1054; Protein HS1; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; protein phosphatase 1, regulatory subunit 170; protein tau; protein, theta; R74690; SEZ-2; SFN; Stratifin; tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein gamma; tryosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; tryosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta polypeptide; tryosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma; tyrosine 3/tryptophan 5 -monooxygenase activation protein beta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, beta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein, beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, beta polypeptide; tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta L homeolog; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta S homeolog; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma L homeolog; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma S homeolog |
| Gene | YWHAB |
| Product Type | Antibody |
| Gene ID (Entrez) | 100505434, 10971, 22627, 22628, 22630, 22631, 25577, 25578, 2810, 282125, 286862, 286863, 287022, 29753, 313017, 379724, 380457, 399276, 432005, 528453, 54401, 55948, 56010, 56011, 7529, 7531, 7532, 7534, 768311 |
| Formulation | PBS with 0.1% sodium azide; pH 7.4 |
| Immunogen | A 20 amino acid synthetic peptide derived from the N-terminus of the human 14-3-3 beta/alpha protein. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ NF-H Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Chicken Polyclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Human,Mouse,Rat,Canine,Bovine,Pig,Horse |
| Host Species | Chicken |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Multiplex Immunohistochemistry |
| Form | Liquid |
| Gene Accession No. | P12036, P12037, P16884, P19246 |
| Isotype | IgY |
| Concentration | Conc. Not Determined |
| Antigen | NF-H |
| Gene Symbols | Nefh |
| Regulatory Status | RUO |
| Purification Method | PEG precipitation |
| Gene Alias | 200 kDa neurofilament protein; CMT2CC; heavy neurofilament protein; I79_012512; intermediate filament protein; KIAA0845; LOW QUALITY PROTEIN: neurofilament heavy polypeptide; mKIAA0845; NEF3; Nefh; nefh.L; neurofilament; neurofilament 200kDa; neurofilament heavy; neurofilament heavy L homeolog; neurofilament heavy polypeptide; neurofilament heavy polypeptide-like; neurofilament triplet H protein; neurofilament, heavy polypeptide; neurofilament, heavy polypeptide 200kDa; neurofilament, heavy polypeptide L homeolog; neurofilament-H; NF 200 kD; NF200; Nfh; NF-H; NHC; XELAEV_18007418mg |
| Gene | Nefh |
| Product Type | Antibody |
| Gene ID (Entrez) | 100064328, 100156492, 24587, 380684, 442940, 4744, 528842 |
| Formulation | PBS with 0.02% sodium azide |
| Immunogen | Native NF-H purified from bovine spinal cord. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ HTR2A Polyclonal Antibody
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Polyclonal Antibody
| Content And Storage | -20°C |
|---|---|
| Target Species | Human,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry (Paraffin),Western Blot |
| Form | Lyophilized |
| Gene Accession No. | P14842, P28223 |
| Isotype | IgG |
| Concentration | 500 μg/mL |
| Antigen | HTR2A |
| Gene Symbols | Htr2a |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | 5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A |
| Gene | Htr2a |
| Product Type | Antibody |
| Gene ID (Entrez) | 29595, 3356 |
| Formulation | PBS with 5mg BSA and 0.05mg sodium azide |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) . |
| Classification | Polyclonal |
| Primary or Secondary | Primary |